DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and ReepA

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster


Alignment Length:113 Identity:37/113 - (32%)
Similarity:58/113 - (51%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSL 116
            |:||.||        :|.|   |.|||||.|...:.:...::.::|::||:.|..||.||.:..:
  Fly   151 SLLFPAF--------RLFC---GTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDI 204

  Fly   117 LTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLHDPVD 164
            ..|.:|||:.:|...:.|.:.|..:..||| |.|.|.|...:....:|
  Fly   205 FISWLPFYYEVKVALVFWLLSPATKGSSTL-YRKFVHPMLTRHEQEID 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 30/87 (34%)
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.