DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and Reep6

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001013236.1 Gene:Reep6 / 362835 RGDID:1309508 Length:211 Species:Rattus norvegicus


Alignment Length:172 Identity:70/172 - (40%)
Similarity:103/172 - (59%) Gaps:12/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NGYKQDINRSLRDASKPWTKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLY 77
            :|.:|...|.|...:.. |.|..:||.:||||:..:..|::.....||:||:.|.||||:||.:|
  Rat     2 DGLRQRFERFLEQKNVA-TDALGALEARTGVEKRYLAAGALTLLGLYLLFGYGASLLCNVIGFVY 65

  Fly    78 PAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERN 142
            |||.|:..|||..|:||..||.|||.:.:|.::||:..||....|||:..||.||::||.|...|
  Rat    66 PAYASVKAIESPNKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWN 130

  Fly   143 GSTLIYHKLVRPYFLKLHDPVDM-----------MSAGVPKD 173
            |:.|:||:::||.|||.|..:|.           ::||:.:|
  Rat   131 GALLLYHRVIRPLFLKHHVALDSAASQLSGRALDIAAGITRD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 43/87 (49%)
Reep6NP_001013236.1 TB2_DP1_HVA22 66..143 CDD:397309 36/76 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6168
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3919
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm9038
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X536
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.