DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and Reep1

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_038963735.1 Gene:Reep1 / 362384 RGDID:1305230 Length:310 Species:Rattus norvegicus


Alignment Length:93 Identity:32/93 - (34%)
Similarity:51/93 - (54%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCM 136
            |.|.|||||.|...::|...::.::|::||:.|.:||..|.:..:.....|||:.||..|:.|.:
  Rat    22 IFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWLL 86

  Fly   137 LPTERNGSTLIYHKLVRPYFLKLHDPVD 164
            .|..: ||:|:|.|.|.|........:|
  Rat    87 SPYTK-GSSLLYRKFVHPTLSSKEKEID 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 30/81 (37%)
Reep1XP_038963735.1 TB2_DP1_HVA22 28..103 CDD:397309 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.