DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and Reepl1

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_572730.1 Gene:Reepl1 / 32103 FlyBaseID:FBgn0030313 Length:240 Species:Drosophila melanogaster


Alignment Length:98 Identity:29/98 - (29%)
Similarity:55/98 - (56%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LVFGWCAQLLCNIIGVLYPAYISIHGIES-STKQDDIR-WLIYWVTFGIFTVIEFYPSLLTSMIP 122
            :::.....:|..::|..|||:.|...::| :...:|:| |||||:.:|::...:::.:.|.:.||
  Fly     1 MIYAIVIHILSLLVGCFYPAFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGLLAFIP 65

  Fly   123 FYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPY 155
            .....|...|.| |||:...||.:||.:.:|.:
  Fly    66 LLSEFKVLLLFW-MLPSVGGGSEVIYEEFLRSF 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 28/89 (31%)
Reepl1NP_572730.1 TB2_DP1_HVA22 8..95 CDD:281172 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452749
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - P PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.