DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and Reep3

DIOPT Version :10

Sequence 1:NP_651429.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001191844.1 Gene:Reep3 / 28193 MGIID:88930 Length:267 Species:Mus musculus


Alignment Length:93 Identity:32/93 - (34%)
Similarity:53/93 - (56%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCM 136
            :.|:|||||.|...:::...::.:||::||:.|.::||||.......:..|.|:.||..|:||.:
Mouse    13 VFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLAWFPLYYELKIAFVIWLL 77

  Fly   137 LPTERNGSTLIYHKLVRPYFLKLHDPVD 164
            .|..| |::|||.|.:.|........:|
Mouse    78 SPYTR-GASLIYRKFLHPLLSSKEREID 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_651429.1 TB2_DP1_HVA22 78..155 CDD:460820 27/76 (36%)
Reep3NP_001191844.1 TB2_DP1_HVA22 19..95 CDD:460820 27/76 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..232
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.