DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and SPBC30D10.09c

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_596276.1 Gene:SPBC30D10.09c / 2540280 PomBaseID:SPBC30D10.09c Length:217 Species:Schizosaccharomyces pombe


Alignment Length:114 Identity:30/114 - (26%)
Similarity:43/114 - (37%) Gaps:22/114 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 QLLCNIIGVLYPAYISIHGIESSTKQDDI--------------------RWLIYWVTFGIFTVIE 111
            :.|..|||..||.|.:...:|..:|:..:                    |.:.||..:|..|..|
pombe    53 EFLSTIIGAGYPIYKTYLLLELPSKRSQLLPKAFQLRNEEHKSIEEERRRLMAYWCVYGCVTAAE 117

  Fly   112 FYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLH 160
            .......|.:|||...|..|.:|.:.| ...|:..||...:.| ||..|
pombe   118 SILGRFLSWVPFYSTSKIVFWLWLLNP-RTQGAAFIYASYISP-FLSDH 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 26/106 (25%)
SPBC30D10.09cNP_596276.1 TB2_DP1_HVA22 2..208 CDD:303060 30/114 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.