DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and yop1

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_588478.1 Gene:yop1 / 2539171 PomBaseID:SPCC830.08c Length:182 Species:Schizosaccharomyces pombe


Alignment Length:155 Identity:58/155 - (37%)
Similarity:87/155 - (56%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAQVSQVQRFFNGYKQDINRSLRDASKPWTKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWC 65
            |:.||...|..     ||::..|  |:.|   ..:|||:..||.::.:|:.:....|.:|...|.
pombe     1 MSFQVRVKQNM-----QDLDNRL--AAFP---QLNSLEKNFGVSKLYVFLTAAGIYALFLFLNWG 55

  Fly    66 AQLLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCT 130
            ..||.|::....||:.||:.||::.|.||.:||.|::......|||::..|:...:|.|||||..
pombe    56 GFLLTNLLAFAMPAFFSINAIETTNKADDTQWLTYYLVTSFLNVIEYWSQLILYYVPVYWLLKAI 120

  Fly   131 FLIWCMLPTERNGSTLIYHKLVRPY 155
            ||||..|| :.||:|:||..|:|||
pombe   121 FLIWLALP-KFNGATIIYRHLIRPY 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 37/87 (43%)
yop1NP_588478.1 YOP1 3..182 CDD:227385 57/153 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2065
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 122 1.000 Inparanoid score I1481
OMA 1 1.010 - - QHG57200
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - otm47152
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.