powered by:
Protein Alignment CG4960 and CG30177
DIOPT Version :9
Sequence 1: | NP_001287533.1 |
Gene: | CG4960 / 43115 |
FlyBaseID: | FBgn0039371 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_726366.1 |
Gene: | CG30177 / 246500 |
FlyBaseID: | FBgn0050177 |
Length: | 206 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 26/71 - (36%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 GVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLI--WCM 136
|.|.|.:.|:..|....:.....||.|||.:.:...:......|...:.||..||....: |..
Fly 10 GTLLPGWSSLRAIGHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLILSVGLWFS 74
Fly 137 LPTERN 142
.|...|
Fly 75 APYSTN 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.