DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and Reep2

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_659114.2 Gene:Reep2 / 225362 MGIID:2385070 Length:254 Species:Mus musculus


Alignment Length:99 Identity:33/99 - (33%)
Similarity:56/99 - (56%) Gaps:1/99 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AQLLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCT 130
            ::|:..|.|.|||||.|...:::...::.::|::||:.|..||..|....::.|..|||:.||..
Mouse     7 SRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIILSWFPFYFELKIA 71

  Fly   131 FLIWCMLPTERNGSTLIYHKLVRPYFLKLHDPVD 164
            |:||.:.|..: ||:::|.|.|.|........:|
Mouse    72 FVIWLLSPYTK-GSSVLYRKFVHPTLSNKEKEID 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 31/87 (36%)
Reep2NP_659114.2 TB2_DP1_HVA22 19..94 CDD:308643 26/75 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.