DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and Reep2

DIOPT Version :10

Sequence 1:NP_651429.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_659114.2 Gene:Reep2 / 225362 MGIID:2385070 Length:254 Species:Mus musculus


Alignment Length:99 Identity:33/99 - (33%)
Similarity:56/99 - (56%) Gaps:1/99 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AQLLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCT 130
            ::|:..|.|.|||||.|...:::...::.::|::||:.|..||..|....::.|..|||:.||..
Mouse     7 SRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIILSWFPFYFELKIA 71

  Fly   131 FLIWCMLPTERNGSTLIYHKLVRPYFLKLHDPVD 164
            |:||.:.|..: ||:::|.|.|.|........:|
Mouse    72 FVIWLLSPYTK-GSSVLYRKFVHPTLSNKEKEID 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_651429.1 TB2_DP1_HVA22 78..155 CDD:460820 26/76 (34%)
Reep2NP_659114.2 TB2_DP1_HVA22 19..94 CDD:460820 26/75 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..254
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.