DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and W01D2.3

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_497069.2 Gene:W01D2.3 / 189092 WormBaseID:WBGene00012180 Length:243 Species:Caenorhabditis elegans


Alignment Length:114 Identity:22/114 - (19%)
Similarity:49/114 - (42%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDIRWL 98
            |..:|...|..|.:.|.|::......::.......:...:.::.|.::::..|.|::..::..:|
 Worm    88 FREIERVFGRRREHCFYGALGVLLTLVLLNDAVGAITAFMTLIIPTFMTVTAISSTSSYENPSFL 152

  Fly    99 --------IYWVTFGIFTVIEFYPSLLTSMIPFYW---LLKCTFLIWCM 136
                    .||..:.:|...|   |.|:|:|  :|   |.:..|:..|:
 Worm   153 KNHQDFFVRYWTVYAVFVTGE---SFLSSLI--HWDLRLFRLIFMSMCL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 16/82 (20%)
W01D2.3NP_497069.2 TB2_DP1_HVA22 122..>182 CDD:281172 12/64 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.