DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and F56B3.6

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_499990.1 Gene:F56B3.6 / 176906 WormBaseID:WBGene00018930 Length:205 Species:Caenorhabditis elegans


Alignment Length:126 Identity:46/126 - (36%)
Similarity:70/126 - (55%) Gaps:1/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVT 103
            |..|.:|.::...:....||:||||..|:||||:||..||.|.|:..|.|....||..|||||..
 Worm    73 ESAGFKRDHLSYAAFGLIAFFLVFGSVARLLCNLIGFGYPTYASVKAIRSPGGDDDTVWLIYWTC 137

  Fly   104 FGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLHDPVD 164
            |.:..:::|:...:.|..|||::.|..||::..|| :..||.:.|..:|.|..:.:...:|
 Worm   138 FAVLYLVDFFSEAILSWFPFYYIAKACFLVYLYLP-QTQGSVMFYETIVDPLVIFVDKNLD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 35/87 (40%)
F56B3.6NP_499990.1 TB2_DP1_HVA22 100..187 CDD:281172 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160984
Domainoid 1 1.000 89 1.000 Domainoid score I4957
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.