DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and T03F6.6

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_499756.3 Gene:T03F6.6 / 176759 WormBaseID:WBGene00011401 Length:207 Species:Caenorhabditis elegans


Alignment Length:163 Identity:57/163 - (34%)
Similarity:90/163 - (55%) Gaps:20/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YKQDINRSLRDASKPWTKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPA 79
            ||:::.:               ||:.||::|..:..|.|.....|::.|..|:.:||:|||.|||
 Worm    41 YKENVKK---------------LEDATGLKREMLAYGLIGLNCVYMIIGSGAEFVCNLIGVAYPA 90

  Fly    80 YISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGS 144
            |:|:..|.:....||..|||||..||.|::|:|:.:.:.|..|.||:.|..||::..|| |.:||
 Worm    91 YVSVKAIRTEGTDDDTMWLIYWTVFGAFSIIDFFAASIMSYFPIYWVAKAAFLLYLYLP-ETHGS 154

  Fly   145 TLIYHKLVRPYFLKLHDPVDM---MSAG-VPKD 173
            .:|||:|:.|:...:...:..   .:|| ||.|
 Worm   155 HVIYHQLIDPFVAHMEKSMSRKLPANAGTVPND 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 40/87 (46%)
T03F6.6NP_499756.3 TB2_DP1_HVA22 77..164 CDD:281172 40/87 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160983
Domainoid 1 1.000 89 1.000 Domainoid score I4957
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.