DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and yop-1

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_491033.1 Gene:yop-1 / 171835 WormBaseID:WBGene00022127 Length:183 Species:Caenorhabditis elegans


Alignment Length:158 Identity:63/158 - (39%)
Similarity:100/158 - (63%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QVQRFFNGYKQDINRSLRDASKPWTKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCN 71
            |||:..:    |:::.|.:.|.. |....::|:||||:|:::.:|.:...|.||:||..|||:||
 Worm     6 QVQKVLD----DVDKQLHEPSTV-TNVLATVEQKTGVKRLHLVLGVVGLQALYLIFGHSAQLVCN 65

  Fly    72 IIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCM 136
            .:|.:||||:||..||||.|:||.:||.|||.|.|.:|:||:...:.::.|.|||.|..||::..
 Worm    66 FMGFVYPAYMSIKAIESSNKEDDTQWLTYWVIFAILSVVEFFSVQIVAVFPVYWLFKSIFLLYLY 130

  Fly   137 LPTERNGSTLIYHKLVRPYFLKLHDPVD 164
            ||:.. |:..:||:.|:|...:....:|
 Worm   131 LPSFL-GAAKLYHRFVKPVAARHSGSID 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 42/87 (48%)
yop-1NP_491033.1 TB2_DP1_HVA22 60..147 CDD:281172 42/87 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160980
Domainoid 1 1.000 89 1.000 Domainoid score I4957
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 158 1.000 Inparanoid score I2893
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - otm14231
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.