DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4960 and Reep5

DIOPT Version :9

Sequence 1:NP_001287533.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_031900.3 Gene:Reep5 / 13476 MGIID:1270152 Length:189 Species:Mus musculus


Alignment Length:143 Identity:72/143 - (50%)
Similarity:92/143 - (64%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDI 95
            |.....||.||||.|..|.:|.|...|.|||||:.|.||||:||..||||||:..|||..|.||.
Mouse    20 TDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDT 84

  Fly    96 RWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLH 160
            :||.|||.:|:|::.||:..|..|..|||::|||.||:|||.|:..||:.::|.:::||.|||..
Mouse    85 QWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPANGAEMLYRRIIRPIFLKHE 149

  Fly   161 DPVDMMSAGVPKD 173
            ..||    .|.||
Mouse   150 SQVD----SVVKD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4960NP_001287533.1 TB2_DP1_HVA22 66..154 CDD:281172 45/87 (52%)
Reep5NP_031900.3 TB2_DP1_HVA22 55..143 CDD:281172 45/87 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849931
Domainoid 1 1.000 110 1.000 Domainoid score I6307
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 177 1.000 Inparanoid score I4021
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm8791
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.