DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and PFA4

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_014640.1 Gene:PFA4 / 854159 SGDID:S000005363 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:57/217 - (26%)
Similarity:84/217 - (38%) Gaps:51/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MGLLHPFCAIFLLCLIGLLFVYELCYVLPQ-ITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTN 101
            :|:..|   .||:..||....|   ::|.. ::.|..|..:.|..|       |..:::|...||
Yeast    10 LGIAIP---TFLISFIGYGAHY---FILSNFLSVPKQITFEFCLSM-------IWLSYYLAICTN 61

  Fly   102 TSVDSLVLERQYP-VAGEAHLW-HYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKN 164
            ..       |..| ......:| ::|..||...|.||.||..||.|:|..||||.:..:|:|..|
Yeast    62 PG-------RPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFAN 119

  Fly   165 QRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKW--KYTIANLFKL 227
            ..:||.|||                 |    .:|...:|...|  .:...|.|  ::.....||.
Yeast   120 YPHFLRFLF-----------------W----IIVTTSVLFCIQ--AKRIYFIWQQRHLPGYFFKK 161

  Fly   228 NLFLF---GVPLFMFVFQMIMV 246
            :..:|   ..||..||...|.:
Yeast   162 SELIFLTISSPLNSFVLLTITI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 38/129 (29%)
PFA4NP_014640.1 COG5273 1..344 CDD:227598 57/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.