DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and AT4G00840

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_567193.2 Gene:AT4G00840 / 826193 AraportID:AT4G00840 Length:291 Species:Arabidopsis thaliana


Alignment Length:260 Identity:70/260 - (26%)
Similarity:112/260 - (43%) Gaps:62/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GLLHPFCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTS 103
            |.|....|:.:.....||.:....|.....|||..:.......||        |...|...|:|.
plant    47 GALSALAALIIFVFHFLLIMLLWSYFTTVFTDPGSVPEHFRREMG--------GGDSLEAGTSTD 103

  Fly   104 VDSLVLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYF 168
                        .|......||:.|:.:.|||..|||:|..|:||.||||.:..:|:|.:|.::|
plant   104 ------------QGAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFF 156

  Fly   169 LAFLFHLSFGSGQALVYNGILNWTNKAFL--VVDPLLLM------FQDTTQDADFKWKYTIANL- 224
            |.|||:                    .||  ::|.::|:      |....:.:....|  :|:| 
plant   157 LLFLFY--------------------TFLETMLDVIVLLPSFIEFFSQAIKHSSSPGK--LASLV 199

  Fly   225 --FKLNLFLFGVPLFMFVFQMI-MVYRNSTCYKMLDRS------YDVGWRRNFDMVLGKRR-FWI 279
              |.|| |.|.:.|..||...| ::..|:|..::.:::      ||:|.::||:.|.||:: ||:
plant   200 LAFVLN-FAFVLSLLCFVVMHISLLSSNTTSVEVHEKNGEVRWKYDLGKKKNFEQVFGKKKAFWL 263

  Fly   280  279
            plant   264  263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 43/139 (31%)
AT4G00840NP_567193.2 zf-DHHC 4..266 CDD:303066 70/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.