Sequence 1: | NP_651428.2 | Gene: | CG4956 / 43114 | FlyBaseID: | FBgn0039370 | Length: | 302 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016866796.1 | Gene: | ZDHHC14 / 79683 | HGNCID: | 20341 | Length: | 506 | Species: | Homo sapiens |
Alignment Length: | 215 | Identity: | 52/215 - (24%) |
---|---|---|---|
Similarity: | 81/215 - (37%) | Gaps: | 73/215 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 IYTVINILGNWWLGCMTNTSV------------DSLVLERQYPVA-------------------- 116
Fly 117 GEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGS-- 179
Fly 180 -GQALVYNGILNWTNKAFL---------VVDPLLLMF-------------------QDTTQDADF 215
Fly 216 KWK----------YTIANLF 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4956 | NP_651428.2 | zf-DHHC | 123..251 | CDD:279823 | 39/144 (27%) |
ZDHHC14 | XP_016866796.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |