DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and zdhhc8

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001037871.1 Gene:zdhhc8 / 733453 XenbaseID:XB-GENE-976023 Length:776 Species:Xenopus tropicalis


Alignment Length:225 Identity:55/225 - (24%)
Similarity:96/225 - (42%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LIG---LLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLERQY 113
            |:|   |.||:...::..:|:....:::.|.:..       :|.|:.:....:..:        :
 Frog    24 LVGSTTLFFVFTCPWLTREISPAIPVYNGLMFLF-------VLANFSMATFMDPGI--------F 73

  Fly   114 PVAGE---------AHLW------------HYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFA 157
            |.|.|         |.|:            .:|:||....|||..|||:|:.|:...||||.:..
 Frog    74 PRADEDEDKDDDFRAPLYKNVEIKRIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVN 138

  Fly   158 SCIGHKNQRYFLAFLFHLSFGSGQALVYN-GILNWTNKAFLVVDPLLLMFQDTTQDADFKWKYTI 221
            :|||.:|.|||  |||.||..:....|:: |::       .|:..|.::.:..|       ..||
 Frog   139 NCIGRRNYRYF--FLFLLSLSTHMIGVFSFGLI-------FVLHHLEVLGEAHT-------SITI 187

  Fly   222 ANLFKLNLFLFGVPLFMFVFQMIMVYRNST 251
            :.:....||...| :.:..|.:::|.|..|
 Frog   188 SVMCVAGLFFIPV-IGLTGFHIVLVVRGRT 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 40/128 (31%)
zdhhc8NP_001037871.1 DHHC 99..224 CDD:366691 41/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.