DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:243 Identity:61/243 - (25%)
Similarity:97/243 - (39%) Gaps:60/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FH-RH--FQLHRIKVMGLLHP--FCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIY 85
            || ||  |.:..:.:.||::.  .|.:|..|       .||.:.||.:..|             |
Mouse    61 FHTRHPTFIVLHLLLQGLVYAEYTCEVFGYC-------RELEFSLPYLLLP-------------Y 105

  Fly    86 TVINI-LGNWWLGCMTNTSV-----DSLVL------ERQYPVAGEAHLWHYCSTCQKLVPPRSWH 138
            .:::: |..:.|.|..|...     :|.:|      :..:|....      |.||....|.||.|
Mouse   106 VLLSVNLVFFTLTCAANPGTITKANESFLLQVYKFDDVMFPKNSR------CPTCDLRKPARSKH 164

  Fly   139 CSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFL-----V 198
            |.||:.|:.:.||||.:..:|||..|.||||.:|..|:..:       ..:.....|||     |
Mouse   165 CRLCDRCVHRFDHHCVWVNNCIGAWNTRYFLIYLLTLTASA-------ATIATVTAAFLLRLVTV 222

  Fly   199 VDPLLLMFQDTTQDADFKWKYTIANLFKLNLFLFGVPLFMFVFQMIMV 246
            .|    ::|:|..| |......:..:|.:.......|..:|:...::|
Mouse   223 SD----LYQETYLD-DVGHFQAVDTVFLIQHLFLAFPRIVFLLGFVIV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 38/129 (29%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 38/127 (30%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.