DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001028745.1 Gene:Zdhhc6 / 66980 MGIID:1914230 Length:413 Species:Mus musculus


Alignment Length:339 Identity:79/339 - (23%)
Similarity:112/339 - (33%) Gaps:130/339 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MGLLHPFCAIF---------LLCLIG---LLFVYELCYVLPQITDPHGIWHKLCWFMGIYTV--- 87
            ||:   ||::.         .||..|   .|.|..:|..:..|       ..:.|:..::|.   
Mouse     1 MGI---FCSVIKFENLQDLRRLCHWGPIIALGVIAICSTMAMI-------DSVLWYWPLHTTGGS 55

  Fly    88 IN--ILGNWWL-------------------GCMTNTSVDSLVLERQYPVAGEAHLWHYCSTCQKL 131
            :|  :|.||.:                   |.....|.||:.|:             ||..||..
Mouse    56 VNFIMLINWTVMILYNYFNAMFAGPGFVPRGWKPEKSQDSMYLQ-------------YCKVCQAY 107

  Fly   132 VPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAF 196
            ..|||.||..||.|::|.||||.:..:|.||:|...|..||.....|.            |:.||
Mouse   108 KAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASFTLFLLLAPLGC------------THAAF 160

  Fly   197 LVVDPLLLMFQDTTQDADFKWKYTIANL-----------------FKLNLFLFGVPL-------F 237
            :.|   :.|:........|.|.....::                 |...||..|:.|       .
Mouse   161 IFV---MTMYTQLYNRLSFGWNTVKIDMSAARRDPPPIVPFGLAAFAATLFALGLALGTTIAVGM 222

  Fly   238 MFVFQMIMVYRNSTC--------------YKMLDR----SYDVG--WRRNFDMVLGKRRFWIFFS 282
            :|..|:.::.||.|.              |..||.    .||:|  | :||..|.          
Mouse   223 LFFIQIKIILRNKTSIESWIEEKAKDRIQYYQLDEVFIFPYDMGSKW-KNFKQVF---------- 276

  Fly   283 PTISSPLPTDGTQW 296
             |.|.....||.:|
Mouse   277 -TWSGVPEGDGLEW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 41/151 (27%)
Zdhhc6NP_001028745.1 DHHC 95..241 CDD:366691 44/173 (25%)
SH3_2 317..396 CDD:369452
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.