DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and zdhhc12b

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_021327289.1 Gene:zdhhc12b / 569129 ZFINID:ZDB-GENE-070705-356 Length:270 Species:Danio rerio


Alignment Length:175 Identity:46/175 - (26%)
Similarity:69/175 - (39%) Gaps:46/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQ--ALVYNG 187
            |..|....|.||.||..|..|:.:.||||.:..:|:|.:|.|:|:.:|      :.|  .|::..
Zfish   104 CGHCLVQQPMRSKHCQTCQHCVRRYDHHCPWIENCVGERNHRWFVLYL------AVQLVVLLWGL 162

  Fly   188 ILNWTNKAFLVVDPLLLMFQDTTQDADFKWKYT----------IANLFKLNLFLFGVPLFMFVFQ 242
            .:.|:.          .....|.|    :|..|          :|.|....|.|.|..|:     
Zfish   163 YMAWSG----------FSHASTWQ----QWLRTNGVLLGAAAVVAILALTVLLLLGSHLY----- 208

  Fly   243 MIMVYRNSTCYKMLDR---SY--DVGWRRN-FDMVLGKRRFWIFF 281
              :|..|:|.::.:.|   ||  ..|...| ||..: .|..|.||
Zfish   209 --LVSLNTTTWEFMSRHRISYLKHCGADENPFDKGI-LRNLWGFF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 34/137 (25%)
zdhhc12bXP_021327289.1 zf-DHHC 97..>171 CDD:307600 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.