DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and ZDHHC9

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens


Alignment Length:288 Identity:59/288 - (20%)
Similarity:101/288 - (35%) Gaps:96/288 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSTCGWSRRMCFRAEEGFHRHFQLHRIKVMGLLHPFCAIFLLCLIGLLFVYELCYVLPQITDPHG 73
            |:|.....|:....::|.   |.|....::|.    |.:|        |.:|..|:..|::....
Human    20 RNTFCCDGRVMMARQKGI---FYLTLFLILGT----CTLF--------FAFECRYLAVQLSPAIP 69

  Fly    74 IWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLERQYP------------------------ 114
            ::..:.:...:.|::.          |:.| |..|:.|..|                        
Human    70 VFAAMLFLFSMATLLR----------TSFS-DPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPP 123

  Fly   115 -------VAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFL 172
                   :..:.....||.||:...|||:.|||:|:.|:.:.||||.:..:|:|.:|.|||..|:
Human   124 PRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFI 188

  Fly   173 FHLSFGSGQALVYNGI---LNWTNKAFL---------VVDPLLLMF------------------- 206
            ..||..:.....:|.:   |......||         |::.|:..|                   
Human   189 LSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALN 253

  Fly   207 QDTTQDADFKW--------KYTIANLFK 226
            |.|.:|....|        .|:..|:.|
Human   254 QTTNEDIKGSWTGKNRVQNPYSHGNIVK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 39/143 (27%)
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 35/122 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.