DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_006539081.1 Gene:Zdhhc18 / 503610 MGIID:3527792 Length:407 Species:Mus musculus


Alignment Length:245 Identity:62/245 - (25%)
Similarity:104/245 - (42%) Gaps:70/245 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AIFLLCLIG---LLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTS---- 103
            |:.||.::.   |.||::..|:...:|            :.|..:..||..:.:.|:..||    
Mouse    87 ALTLLLILSTTILFFVFDCPYLARTLT------------LAIPIIAAILFFFVMSCLLQTSFTDP 139

  Fly   104 --------VDSLVLERQYP-----------------VAGEAHLWHYCSTCQKLVPPRSWHCSLCN 143
                    .::..||:|..                 :.|:.....||.||:...|||:.|||:|:
Mouse   140 GILPRATICEAAALEKQIDNTGSSTYRPPPRTREVMINGQTVKLKYCFTCKMFRPPRTSHCSVCD 204

  Fly   144 ICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFL---VVDPLLLM 205
            .|:.:.||||.:..:|:|.:|.|:|.||:..|||.:               ||:   ||..|.|:
Mouse   205 NCVERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLT---------------AFIFACVVTHLTLL 254

  Fly   206 FQDTTQDADF--KWKYTIANLFKLNLFLFGV--PLFMFVFQMIMVYRNST 251
                :|.::|  ..|.|.|::.:|.:..|.:  .|.:..|...:|..|.|
Mouse   255 ----SQGSNFLSALKKTPASVLELVICFFSIWSILGLSGFHTYLVASNLT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 43/134 (32%)
Zdhhc18XP_006539081.1 DHHC 183..306 CDD:366691 44/137 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.