| Sequence 1: | NP_651428.2 | Gene: | CG4956 / 43114 | FlyBaseID: | FBgn0039370 | Length: | 302 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001008650.2 | Gene: | zdhhc13 / 494107 | ZFINID: | ZDB-GENE-041212-79 | Length: | 645 | Species: | Danio rerio |
| Alignment Length: | 215 | Identity: | 52/215 - (24%) |
|---|---|---|---|
| Similarity: | 76/215 - (35%) | Gaps: | 72/215 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 124 YCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGI 188
Fly 189 LNWTN---------------KAFLVVDPLLL-----MFQDTTQDADFKWK--------YTIANL- 224
Fly 225 ---------------------FKLNLFLFGVPLFMFVFQMIMVYRNSTCYKMLDRSYDVGWRRNF 268
Fly 269 DMVLGKRRFWIFFSPTISSP 288 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4956 | NP_651428.2 | zf-DHHC | 123..251 | CDD:279823 | 42/176 (24%) |
| zdhhc13 | NP_001008650.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..73 | ||
| ANKYR | <62..204 | CDD:223738 | |||
| ANK repeat | 76..102 | CDD:293786 | |||
| ANK repeat | 104..135 | CDD:293786 | |||
| ANK 1. /evidence=ECO:0000255 | 104..133 | ||||
| PHA03095 | 115..>312 | CDD:222980 | |||
| ANK repeat | 137..169 | CDD:293786 | |||
| ANK 2. /evidence=ECO:0000255 | 138..167 | ||||
| ANK 3. /evidence=ECO:0000255 | 171..200 | ||||
| ANK repeat | 176..202 | CDD:293786 | |||
| ANK repeat | 204..236 | CDD:293786 | |||
| ANK 4. /evidence=ECO:0000255 | 204..234 | ||||
| ANK repeat | 239..270 | CDD:293786 | |||
| ANK 5. /evidence=ECO:0000255 | 239..268 | ||||
| DHHC | 450..580 | CDD:396215 | 37/136 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||