DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and CG5196

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:308 Identity:68/308 - (22%)
Similarity:112/308 - (36%) Gaps:79/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GFHRHFQLHRIKVMGLLH--PFCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTV 87
            ||.|           .||  |..|:.::..|.|..:|......|......|..|:     .::.:
  Fly     7 GFRR-----------FLHWGPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQ-----ALFLL 55

  Fly    88 INILG--NWWLGCMTNTSVDSLVLERQYPV-AGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKR 149
            ::.|.  |:.:..:|.   ..|:.::.:|. ..:|....||..|:....|||.||..|:.|:.|.
  Fly    56 LSTLATFNYVMATLTG---PGLMPKQWHPKDPKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKM 117

  Fly   150 DHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVY----------------NGILNWTNKAFLV 198
            ||||.:...|:|..|..||..||.....||.|..|.                :|:.:..:..|.:
  Fly   118 DHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLASVQFTL 182

  Fly   199 VDPLLLMFQDTTQDADFKWKYTIANLFKLNLFLF-----------GVPLFMFVFQMIMVYRNSTC 252
            :..::.:         ......|..:..|::.||           |:.:::....:...|||:.|
  Fly   183 LSIIMCI---------LGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADC 238

  Fly   253 YKMLDRSYDVGWRRNFDMVLG----KRRFWIFFSPTISSPLPTDGTQW 296
            .......||:|||.|..:|..    ||               .||.:|
  Fly   239 DDEFLYPYDLGWRANLRLVFNDECQKR---------------GDGIEW 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 36/154 (23%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 33/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.