DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and zgc:77880

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_957185.1 Gene:zgc:77880 / 393865 ZFINID:ZDB-GENE-040426-1901 Length:297 Species:Danio rerio


Alignment Length:308 Identity:73/308 - (23%)
Similarity:118/308 - (38%) Gaps:93/308 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LCLIGLLF-VYELCYVLPQ-ITDP---HGIWHKLCWFMGIYTVINILGNWWLGC----------- 98
            :|||...| |:...||:.| :..|   ..:|   |...|  :|.||:....|.|           
Zfish    14 ICLILTYFSVFYADYVVIQYVLIPAYSGSVW---CTLHG--SVFNIILFLLLACHSKAVFSDPGM 73

  Fly    99 --MTNTSVDSLVLERQYPVAGE--AHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASC 159
              :..|::|...|..|.....:  ...|..||.|:...|||:.||.:|..||.:.||||.:..:|
Zfish    74 VPLPETAIDFSDLRSQSNRLNDRGCEGWTVCSRCETYRPPRAHHCRVCQRCIRRMDHHCPWINNC 138

  Fly   160 IGHKNQRYFLAFLFHLSFGSGQALVYNGIL---NWT-------------------NKAFLVVDPL 202
            :|..||:||:.|||:    :|.|.:|:..|   .|.                   :|..:|...:
Zfish   139 VGELNQKYFIQFLFY----TGMASLYSMALVVSAWVWRIRSEREGDEEKEGEEAPSKHLIVAHYI 199

  Fly   203 LLMFQDTTQDADFKWKYTIANLFKLNLFLFGV-PLFMFVFQMIMVYRNSTCYKML------DRSY 260
            :|:.:.                     .|||| .|.:|..|::.:..:.|..:.:      |::.
Zfish   200 ILLVES---------------------ILFGVFVLVIFYDQLVSIITDETPIEQMRNRLIKDKAN 243

  Fly   261 D-----VGWRRNFDMVLGKRRF-------WIFFSPTISSPLPTDGTQW 296
            :     |...|...:.|.:..|       |:|  |..|:|....|..:
Zfish   244 NSQPSHVAHTRKPKIALLREVFGRGSILCWLF--PLHSTPPSVGGISY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 39/150 (26%)
zgc:77880NP_957185.1 zf-DHHC 12..>164 CDD:303066 49/158 (31%)
zf-DHHC 103..235 CDD:279823 40/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.