DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and CG10344

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster


Alignment Length:267 Identity:86/267 - (32%)
Similarity:129/267 - (48%) Gaps:28/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVL 109
            |.:.:...:.::|::|:..|||...:|.|.:|...:.|.::.|.||.||.....|.:|||:   :
  Fly    17 CFLIIAVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNMIACMMIDTSVN---V 78

  Fly   110 ERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFH 174
            ::..|.:.:.: |..|..||||.|||||||..|.:|||||||||.:...|||.:|.|:|:.|:|:
  Fly    79 KKVEPPSDQLN-WRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFY 142

  Fly   175 LSFGSGQALVYNGILNWTNKAFL---------VVDPLLLMFQDTTQDADFKWKYTIANLFKLNLF 230
            |..||..|||||.|..|.....:         :..|:|.:...:.      |.......:.||:.
  Fly   143 LFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSF------WTNMYLVFYSLNIL 201

  Fly   231 LFGVPLFMFVFQMIMVYRNSTCYKMLDRS------YDVGWRRNFDMVLGKRRFWIFFSPTISSPL 289
            .....:.:..:.:.:|.|...   ..||:      ||.|..:|...|.|.|....:.||.|.|.|
  Fly   202 ALAYGVLLLAYHVPIVLRGGV---SADRTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPLIRSDL 263

  Fly   290 PTDGTQW 296
            |.||..|
  Fly   264 PEDGYHW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 47/136 (35%)
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 46/132 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469545
Domainoid 1 1.000 74 1.000 Domainoid score I9123
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4533
Isobase 1 0.950 - 0 Normalized mean entropy S3153
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
1110.850

Return to query results.
Submit another query.