DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc17

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001034429.1 Gene:Zdhhc17 / 366889 RGDID:1595790 Length:622 Species:Rattus norvegicus


Alignment Length:345 Identity:80/345 - (23%)
Similarity:122/345 - (35%) Gaps:103/345 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIKVMGLLHPFCAIFLLCLI-----------GLLF--VYELCYVLPQITDPHGI----------- 74
            |.||| |..||..|:|:..|           ||::  |:.....|.:....|.:           
  Rat   292 RQKVM-LGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPLGIYLA 355

  Fly    75 ---WHKLCWFMGIYTVINIL-----------------GNWWL---GCMTNTSVDSLVLERQYPVA 116
               |..:.||...:..::.|                 |..|.   |.:..|.........:....
  Rat   356 TKFWMYVTWFFWFWNDLSFLSIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQKKKTIVELAET 420

  Fly   117 GEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQ 181
            |...|..:||||....|.||.||.:||.||.|.||||.:..:|:...|.|||:.:||.|.|....
  Rat   421 GSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVCAGNHRYFMGYLFFLLFMICW 485

  Fly   182 ALVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKWKY----TIANLFKLNLFLFGVPLFMFVFQ 242
             ::|..:..|.            :..:||...|..|.|    ...:.:...:||..|..||:|..
  Rat   486 -MIYGCVSYWG------------LHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFMWVAV 537

  Fly   243 MIM--VYR------------NSTCYK-------MLDRSYDVGWRRN----FDMVLGKRRFWIFFS 282
            ::|  :|:            |:..||       .::..::.|..||    |:.     |....|.
  Rat   538 LLMCQMYQITCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF-----RCCGLFR 597

  Fly   283 PTISSPLPTDGTQWFQKQTV 302
            |.|        ..|.::.|:
  Rat   598 PVI--------VDWTRQYTI 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 43/145 (30%)
Zdhhc17NP_001034429.1 Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250|UniProtKB:Q80TN5 1..295 1/2 (50%)
Ank_4 <60..100 CDD:290365
ANK 77..192 CDD:238125
ANK repeat 79..110 CDD:293786
Ank_2 84..177 CDD:289560
ANK repeat 112..144 CDD:293786
ANK 143..267 CDD:238125
ANK repeat 146..177 CDD:293786
Ank_2 151..245 CDD:289560
ANK repeat 179..211 CDD:293786
ANK repeat 214..245 CDD:293786
zf-DHHC 428..558 CDD:279823 42/142 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.