DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc5

DIOPT Version :10

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001034427.1 Gene:Zdhhc5 / 362156 RGDID:1589737 Length:715 Species:Rattus norvegicus


Alignment Length:167 Identity:50/167 - (29%)
Similarity:72/167 - (43%) Gaps:44/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLE 110
            ||||:....|.|.: .|..|.....|         .:.||..|     .:|..:.|.|:.:.:..
  Rat    21 AIFLVGATTLFFAF-TCPGLSLDVSP---------AVPIYNAI-----MFLFVLANFSMATFMDP 70

  Fly   111 RQYPVAGE---------AHLW------------HYCSTCQKLVPPRSWHCSLCNICILKRDHHCT 154
            ..:|.|.|         |.|:            .:|:||:...|||..|||:|:.|:.:.||||.
  Rat    71 GIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCP 135

  Fly   155 FFASCIGHKNQRYFLAFLFHLS------FGSGQALVY 185
            :..:|||.:|.|||..||..|:      ||.|  |:|
  Rat   136 WVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFG--LLY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 DHHC 123..251 CDD:396215 30/69 (43%)
Zdhhc5NP_001034427.1 DHHC 99..224 CDD:396215 30/74 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.