DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001032741.1 Gene:Zdhhc6 / 361771 RGDID:1304657 Length:413 Species:Rattus norvegicus


Alignment Length:318 Identity:73/318 - (22%)
Similarity:103/318 - (32%) Gaps:118/318 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LCLIG---LLFVYELCYVLPQITDPHGIWHKLCWFMGIYTV---IN--ILGNWWL---------- 96
            ||..|   .|.|..:|..:..|       ..:.|:..::|.   :|  :|.||.:          
  Rat    19 LCHWGPIIALGVIAICSTMAMI-------DSVLWYWPLHTTGGSVNFIMLINWTVMILYNYFNAM 76

  Fly    97 ---------GCMTNTSVDSLVLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHH 152
                     |.......||:.|:             ||..||....|||.||..||.|::|.|||
  Rat    77 FAGPGFVPRGWKPENPQDSMYLQ-------------YCKVCQAYKAPRSHHCRKCNRCVMKMDHH 128

  Fly   153 CTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKW 217
            |.:..:|.||:|...|..||.....|.            |:.||:.|   :.|:........|.|
  Rat   129 CPWINNCCGHQNHASFTLFLLLAPLGC------------THAAFIFV---MTMYTQLYNRLSFGW 178

  Fly   218 KYTIANL-----------------FKLNLFLFGVPL-------FMFVFQMIMVYRNSTC------ 252
            .....::                 |...||..|:.|       .:|..|:.::.||.|.      
  Rat   179 NTVKIDMSAARRDPPPIVPFGLAAFAATLFALGLALGTTIAVGMLFFIQIKIILRNKTSIESWIE 243

  Fly   253 --------YKMLDR----SYDVG--WRRNFDMVLGKRRFWIFFSPTISSPLPTDGTQW 296
                    |..||.    .||:|  | :|...|.           |.|.....||.:|
  Rat   244 EKAKDRIQYYQLDEVFVFPYDMGSKW-KNLKQVF-----------TWSGVPEGDGLEW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 41/151 (27%)
Zdhhc6NP_001032741.1 DHHC 95..241 CDD:396215 44/173 (25%)
SH3_2 317..394 CDD:400139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.