DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and CG1407

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:213 Identity:57/213 - (26%)
Similarity:86/213 - (40%) Gaps:68/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGI 188
            :|..|:.:.|.|:.|||:|:.|:||.||||.:..:|:...|.:||:.||       |.||||   
  Fly   130 FCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFL-------GYALVY--- 184

  Fly   189 LNWTNKAFLVVDPLLLMFQDTTQDADFKWK--------YTIANLFKLN---------LFLFGVPL 236
                        .|.:.|.......:| ||        |:...  :||         ||||.:.:
  Fly   185 ------------CLYVAFTSLHDFVEF-WKVGAYDNNGYSAQG--QLNASGMGRFHILFLFFIAI 234

  Fly   237 F-------MFVFQMIMVYRNSTCYKML----------DRS-YDVGWRRNFDMVLGKR-RFWIFFS 282
            .       :|.:.:.:|..|.|..:..          |:: |::|...||..|.|.. ::|  |.
  Fly   235 MFAISLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYW--FL 297

  Fly   283 PTISS-----PLPTDGTQ 295
            |..||     ..||...|
  Fly   298 PVFSSRGDGYSYPTSSDQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 41/150 (27%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 42/153 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.