DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4956 and zdhhc8b

DIOPT Version :9

Sequence 1:	NP_651428.2	Gene:	CG4956 / 43114	FlyBaseID:	FBgn0039370	Length:	302	Species:	Drosophila melanogaster
Sequence 2:	NP_840089.2	Gene:	zdhhc8b / 352941	ZFINID:	ZDB-GENE-030407-3	Length:	751	Species:	Danio rerio

Alignment Length:	134	Identity:	40/134 - (29%)
Similarity:	56/134 - (41%)	Gaps:	28/134 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   124 YCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLS------FGSGQA 182
            :|:||....|||..|||:|:.|:.:.||||.:..:|||.:|.|||..||..||      |..|
Zfish   105 WCATCHFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLSVHMVGVFSFG-- 167

  Fly   183 LVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKWKYTIANLFKLNLFLFGVPLFMFVFQMIMVY 247
                               ||.|.......:......|:..:....||...| :.:..|.|::|.
Zfish   168 -------------------LLFMLHHLETLSALHTTVTLVVMCVTGLFFIPV-MGLTGFHMVLVA 212

  Fly   248 RNST 251
            |..|
Zfish   213 RGRT 216

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4956	NP_651428.2	zf-DHHC	123..251	CDD:279823	39/132 (30%)
zdhhc8b	NP_840089.2	zf-DHHC	99..224	CDD:279823	40/134 (30%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	293..346
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	437..461
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	633..659
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	666..685
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	703..736
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5273
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810