DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and pfa5

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001018794.2 Gene:pfa5 / 3361262 PomBaseID:SPBC691.01 Length:312 Species:Schizosaccharomyces pombe


Alignment Length:196 Identity:46/196 - (23%)
Similarity:77/196 - (39%) Gaps:47/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGIL 189
            |.||:..:|.||.|..:...||.|.||:|:|....:...||::|..|||:....:...|:...|:
pombe   115 CGTCKCWLPDRSHHSRVSMRCIRKFDHYCSFVGKDVCFSNQKFFYQFLFYGFSAACMVLISTAIM 179

  Fly   190 ------------NW----TNKAFLVVDPLLLMFQDTTQDADFKWKYTIANL-------FKLNLFL 231
                        .|    ...||.|:...:::.:.|        .|.:.|:       :|..::.
pombe   180 ISRTYHYRSLPGTWIFVLVFSAFGVLFLGVMLVRHT--------GYLLLNINSHEAKNWKTRIYS 236

  Fly   232 FGVPLFMFVFQMIMVYRNSTCYKMLDRSYDVGWRRNFDMVLGKRRF-WIFFSPTISSPL---PTD 292
            |.|.....:...::|..:..     |..:|.|:..|:..|:|...: ||.       ||   |.|
pombe   237 FSVFFPEHMDSRVLVQSDPG-----DLPWDRGYSENWRAVMGDHWYNWIL-------PLRRSPGD 289

  Fly   293 G 293
            |
pombe   290 G 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 33/148 (22%)
pfa5NP_001018794.2 COG5273 9..283 CDD:227598 41/187 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.