DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and GABPI

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:177 Identity:44/177 - (24%)
Similarity:80/177 - (45%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFH 174
            ||...:.|:.::   |..|:|:.|.|::||.:|..|:.:||||..:...|||.:|..:::..|..
  Fly   256 ERSGLMHGQPNI---CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLAL 317

  Fly   175 LSFGSGQALVYNGILNWTN--KAFLVVDPL---LLMFQDTT---QDADFKWKYTIANLFKLNLFL 231
                |..||:....|..|:  ..|:||.||   :|:..|.:   :..|....:.:|   ...|.:
  Fly   318 ----SEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVA---CYALLI 375

  Fly   232 FGVPLFMFVFQMIMVYRNSTCYKMLDRSYDVGWRRNFDMVLGKRRFW 278
            .....|:...|..:.::.||.::         ::|..: ..|:.|.|
  Fly   376 SSYIAFILARQAYLWWKGSTLHE---------YKRTSN-AAGRNRIW 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 35/135 (26%)
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 38/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.