DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and zdhhc6

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001191086.1 Gene:zdhhc6 / 324468 ZFINID:ZDB-GENE-030131-3189 Length:412 Species:Danio rerio


Alignment Length:331 Identity:79/331 - (23%)
Similarity:111/331 - (33%) Gaps:120/331 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LHRIKVMGLLHPFCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTV---IN--IL 91
            ||.:|  .|.| :..|..|.:||             :.....|...:.|:..:.|.   ||  :|
Zfish    13 LHEVK--RLFH-WGPIIALTVIG-------------VCSSMAILDSIIWYWPLDTTGGSINFIML 61

  Fly    92 GNWWLGCMTNTSVDSLVLERQYPV--AGEAHL---W-----------HYCSTCQKLVPPRSWHCS 140
            .||.:          |:|...:..  .|..::   |           .:|..||....|||.||.
Zfish    62 INWTV----------LILYNYFNAMFVGPGYIPLEWKPEKQQDIMYLQFCRLCQGYKAPRSHHCR 116

  Fly   141 LCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGS-GQALVYNGILNWTNKAFLVVDPLLL 204
            .||.|::|.||||.:..:|.||.|..||.:||.....|. ..||::                ::.
Zfish   117 KCNRCVMKMDHHCPWINNCCGHLNHAYFTSFLLLAPLGCIHAALIF----------------IMT 165

  Fly   205 MFQDTTQDADFKWK------------------YTIANLFKLNLFLFGVPL-------FMFVFQMI 244
            |:........|.|.                  ::|| .|...||..|:.|       .:|..||.
Zfish   166 MYTQLYDRISFGWSSVKIDMSAARHIHHPIMPFSIA-AFAATLFALGLALGTTIAVGMLFFIQMK 229

  Fly   245 MVYRNSTCY------KMLDR------------SYDVGWR-RNFDMVLGKRRFWIFFSPTISSPLP 290
            ::.||.|..      |..||            .||:|.| .||..|.           |.|....
Zfish   230 VILRNRTSIEAWIEEKAKDRIQYYQTGEDFIFPYDLGSRWENFKQVF-----------TWSGAPM 283

  Fly   291 TDGTQW 296
            .||.:|
Zfish   284 GDGIEW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 42/153 (27%)
zdhhc6NP_001191086.1 DHHC 95..241 CDD:396215 43/162 (27%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 409..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.