DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster


Alignment Length:238 Identity:60/238 - (25%)
Similarity:94/238 - (39%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVIN--ILGNWWL------GCMT 100
            |..|.||....|.|.|...:.:..        |.  |.:....||.  :|.|:.|      |.:.
  Fly    15 FAWIVLLLTTFLFFFYPCQFYVKS--------HP--WVLAYQGVITFFVLANFTLATFMDPGIIP 69

  Fly   101 NTSVDS-------LVLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFAS 158
            ..|.|.       ..|.:...:.|......:|.||:...|||..|||:||.||...||||.:..:
  Fly    70 KASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNN 134

  Fly   159 CIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKWKYTIAN 223
            |||.:|.|:|..||..||.         .:|:..:...:.|..::...:||.         .|..
  Fly   135 CIGRRNYRFFFFFLVSLSI---------HMLSIFSLCLVYVLKIMPNIKDTA---------PIVA 181

  Fly   224 LFKLNLF-LFGVPLF-MFVFQMIMVYRNSTCYKMLDRSYDVGW 264
            :..:.|. :..:|:| :..|.|::|.|..|..:.:...:..|:
  Fly   182 IILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGY 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 39/129 (30%)
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 40/142 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.