DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001034190.1 Gene:Zdhhc15 / 317235 RGDID:1562075 Length:337 Species:Rattus norvegicus


Alignment Length:302 Identity:69/302 - (22%)
Similarity:110/302 - (36%) Gaps:106/302 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FCAIFLLCLIGLL-----FVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMT--- 100
            :..:|.|||:.:|     .:|.:.|        |.|:....|            .:|....|   
  Rat    37 YAYVFELCLVTVLSPAEKVIYLILY--------HAIFVFFAW------------TYWKSIFTLPQ 81

  Fly   101 ----------------------NTSVDSLV-LERQYPV---AGEAHLWHYCSTCQKLVPPRSWHC 139
                                  ......|| :.::.||   .|...: .:|..|..:.|.|..||
  Rat    82 QPNQKFHLSYTDKERYKNEERPEVQKQMLVDMAKKLPVYTRTGNGAV-RFCDRCHLIKPDRCHHC 145

  Fly   140 SLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLL 204
            |:|.:|:||.||||.:..:|||..|.::||.||                      |:.|   |..
  Rat   146 SVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFL----------------------AYSV---LYC 185

  Fly   205 MFQDTTQDADF--KWK---YTIANLFKLNLFLFGVPLFMFVFQMI-------MVYRNSTCYKML- 256
            ::..||..:.|  .|:   .::.:.|.: |||..|....||..:|       :|.||.|..:.. 
  Rat   186 LYIATTVFSYFIKYWRGELPSVRSKFHV-LFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFC 249

  Fly   257 ---------DRSYDVGWRRNFDMVLG-KRRFWIFFSPTISSP 288
                     ...:::|:.:|...|.| .::||:.  |..|||
  Rat   250 TPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLI--PIGSSP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 41/139 (29%)
Zdhhc15NP_001034190.1 zf-DHHC <125..308 CDD:303066 52/194 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.