DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and ZDHHC8

DIOPT Version :10

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001171953.1 Gene:ZDHHC8 / 29801 HGNCID:18474 Length:778 Species:Homo sapiens


Alignment Length:75 Identity:33/75 - (44%)
Similarity:42/75 - (56%) Gaps:14/75 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLS--------FGSG 180
            :|:||....|||..|||:|:.|:...||||.:..:|||.:|.|||..||..||        ||  
Human   105 WCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFG-- 167

  Fly   181 QALVYNGILN 190
              |||  :||
Human   168 --LVY--VLN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 DHHC 123..251 CDD:396215 33/75 (44%)
ZDHHC8NP_001171953.1 DHHC 99..224 CDD:396215 33/75 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..352
PHA03247 <333..771 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..540
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.