DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:133 Identity:37/133 - (27%)
Similarity:58/133 - (43%) Gaps:34/133 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PHGI----WHKLCWF--MGIYTVINILGNWWL----GCM------------TNTSV---DSLVLE 110
            ||.:    |....:|  :|...::.:|.:.|:    .||            |..|:   |:.|.:
  Rat    45 PHPLQIVAWLLYLFFAVIGFGVLVPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRD 109

  Fly   111 RQY----PVAGEAHLWH-----YCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQR 166
            :.|    |:...:...|     :|:.|...|..||.|||.||.|:...||||.:..:|:|.:|.|
  Rat   110 KSYSGPLPIFNRSQHAHVIEDLHCNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYR 174

  Fly   167 YFL 169
            .||
  Rat   175 LFL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 22/52 (42%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.