DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and AT2G14255

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_973453.2 Gene:AT2G14255 / 2745525 AraportID:AT2G14255 Length:536 Species:Arabidopsis thaliana


Alignment Length:334 Identity:79/334 - (23%)
Similarity:121/334 - (36%) Gaps:109/334 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLRSTCGWSRRMCFRAEEGFHRHFQLHRIKVMGLLHP------FC--------AIFLLCLIGLL 56
            ::|:...| |..:...:::| ||...|...|.|.....      ||        |..|..||.:|
plant   219 LILKDNTG-STPLKLASDKG-HRQLALFLSKAMRTRKNSFVDKIFCGKLGETSYAPMLFSLIVIL 281

  Fly    57 FVYELCYV-----LPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLERQYP-- 114
            .|..:..:     ||:||...|:|.......|:|.:|....                :.|:.|  
plant   282 MVLFITSIVSASNLPKITAMVGLWACFGLSCGVYALITFYR----------------VSRKDPGY 330

  Fly   115 --VAGEAHLWH----------------------YCSTCQKLVPPRSWHCSLCNICILKRDHHCTF 155
              ..|||:..|                      .|.||:.:.|.||.||..|..|:.:.||||.:
plant   331 VKRTGEANSQHTANDPLIDINFKNPSWKGNWSQLCPTCKIIRPVRSKHCPTCKRCVEQFDHHCPW 395

  Fly   156 FASCIGHKNQRYFLAFLFH---LSFGSGQALV---YNGI------LNWTNKAFLVVDPLLLMFQD 208
            .::|:|.||:||||.|:..   .||..|...|   :.||      .:|. |..::..|...:|  
plant   396 ISNCVGKKNKRYFLVFVIMGALTSFVGGTTAVQRLWRGIPQVHHGESWI-KHIVIEHPDAAVF-- 457

  Fly   209 TTQDADFKWKYTIANLFKLNLFLFGVPLFMFVFQMIMVYRNSTCYKMLD---------------R 258
                           || .:|.:|...:.:.:.|..|:.||.|..::.:               .
plant   458 ---------------LF-FDLLIFIATMTLTISQSYMIARNITTNELWNAKRFSYLRGPDGRFYN 506

  Fly   259 SYDVGWRRN 267
            .|:.|.|||
plant   507 PYNHGLRRN 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 42/161 (26%)
AT2G14255NP_973453.2 Ank_4 28..78 CDD:290365
ANK repeat 57..88 CDD:293786
ANK 57..85 CDD:197603
Ank_2 62..188 CDD:289560
ANK 85..211 CDD:238125
ANK repeat 92..155 CDD:293786
Ank_5 110..165 CDD:290568
ANK repeat 157..188 CDD:293786
Ank_5 176..233 CDD:290568 3/14 (21%)
ANK repeat 190..214 CDD:293786
ANK repeat 225..254 CDD:293786 8/30 (27%)
zf-DHHC 363..492 CDD:279823 42/147 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.