DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and ZDHHC23

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001307395.1 Gene:ZDHHC23 / 254887 HGNCID:28654 Length:435 Species:Homo sapiens


Alignment Length:178 Identity:48/178 - (26%)
Similarity:79/178 - (44%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKN-QRYFLAFL-FHLSFGSGQALVYN 186
            :|:.||.:.|.|:|||.:|.||:.:.||||.:..||:|..| |.:.||.| |.|:...|..|..:
Human   260 WCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALLIFLLTSVYGITLTLD 324

  Fly   187 GILNWTNKAFLVVDPLLLMFQDTTQDADFK--WKYTIANLFKLNLFLFGVPLFMFVFQMIMVYRN 249
            .|.. ....|..:.....::.:.:....|.  | |::       :...|: .::|:.|:|.:..|
Human   325 TICR-DRSVFTALFYCPGVYANYSSALSFTCVW-YSV-------IITAGM-AYIFLIQLINISYN 379

  Fly   250 ST-----------------CYKMLDR-SYDVGWRRNFDM--VLGKRRF 277
            .|                 |..::|. .|:.|:.||:..  .||.|.|
Human   380 VTEREVQQALRQKTGRRLLCGLIVDTGQYNRGFLRNWHQFSTLGTRAF 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 37/130 (28%)
ZDHHC23NP_001307395.1 MerC 96..>151 CDD:281231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..255
zf-DHHC 258..384 CDD:279823 38/133 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.