DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and ZDHHC24

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_997223.1 Gene:ZDHHC24 / 254359 HGNCID:27387 Length:284 Species:Homo sapiens


Alignment Length:258 Identity:80/258 - (31%)
Similarity:118/258 - (45%) Gaps:33/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IGLLFVYELCYVL-----PQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLERQ 112
            :||    ||.|||     |....|  :...|...:..:.::|:|||..|...::.|:..::|..:
Human    29 VGL----ELAYVLVLGPGPPPLGP--LARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVMLAGR 87

  Fly   113 YPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAF------ 171
                |....|.||..||..|||||.|||.|.:|||:|||||.....|:|..|.|.||..      
Human    88 ----GLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHAAG 148

  Fly   172 -LFHLSFGSGQALVYNGILNW---TNKAFLVVDPLLLMFQDTTQDADFKWKYTIANLFKLNLFLF 232
             |.|:|...|.||  :.:|..   .:.|.|::.|.|::.......|.|...: :.:.......|.
Human   149 VLLHVSVLLGPAL--SALLRAHTPLHMAALLLLPWLMLLTGRVSLAQFALAF-VTDTCVAGALLC 210

  Fly   233 GVPLFMFVFQMIMVYRNSTCYKML--DRSYDVGWRRNFDMVLGKRRFWIFFSPTISSPLPTDG 293
            |..|   :|..:::.|..|.::..  ..|||:|...|....||.|...::..|.::||||.||
Human   211 GAGL---LFHGMLLLRGQTTWEWARGQHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 45/137 (33%)
ZDHHC24NP_997223.1 zf-DHHC 95..234 CDD:279823 46/144 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9123
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4820
Isobase 1 0.950 - 0 Normalized mean entropy S3153
OMA 1 1.010 - - QHG47998
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm40467
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17421
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.820

Return to query results.
Submit another query.