DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and erf2

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_595766.1 Gene:erf2 / 2541058 PomBaseID:SPBC3H7.09 Length:350 Species:Schizosaccharomyces pombe


Alignment Length:291 Identity:73/291 - (25%)
Similarity:112/291 - (38%) Gaps:81/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AIFLLCLIGLLFVYELCYVLPQITDPHGIWHKL-----CWFMGIY--TVINILGNWWLGCMTNTS 103
            ::|.|.|.|:||.         |.....:||.:     ..|..:|  .|:::     ..|.|   
pombe    90 SLFALILPGVLFF---------IFSAFWLWHHVSPAVPITFAYLYALAVVSM-----FKCST--- 137

  Fly   104 VDSLVLERQ-YPVA-GEAHLWH-----------------------YCSTCQKLVPPRSWHCSLCN 143
            .|..:|.|. |.:. ..||.|.                       ||.||....|||:.||.||:
pombe   138 ADPGILPRNAYSLTYNPAHPWSVIPEDRKVLVGSTRSDSVFVNTVYCHTCHLYRPPRASHCHLCD 202

  Fly   144 ICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLLMFQD 208
            .|:...||||.:..:|||.:|.||:..||..:..   .||...|:..:|:         :..|.:
pombe   203 NCVEYLDHHCIWLNTCIGRRNYRYYFIFLLSVVL---SALYLTGLGFYTS---------IGSFHE 255

  Fly   209 TTQDADF------KW---KYTIANLFKLNLFLFGVPLFMFVFQMIMVYRN--------STCYKML 256
            :| |.:|      .|   .:.:.....|...|.|: ||.:...:|.|.:|        ||..:.:
pombe   256 ST-DTNFAAHLRRPWAGVSFFLGIYGALGAILPGI-LFCYQCYLISVGQNVHEYLRAKSTETEDV 318

  Fly   257 DRSYDVGWRRNFDMVLGKRRFWIFFSPTISS 287
            ...:|..| .||.:||.:.:...:..||..|
pombe   319 HPFHDSIW-LNFLVVLCRPKNVSYVRPTRKS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 41/167 (25%)
erf2NP_595766.1 COG5273 57..350 CDD:227598 73/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.