DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:297 Identity:68/297 - (22%)
Similarity:115/297 - (38%) Gaps:68/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KVMGLLHPFCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNW--WLGC 98
            :|:|.:......|::......:|.|||.......:.:|   |...::..:.:..::..|  |:..
Human    12 RVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENG---KTVVYLVAFHLFFVMFVWSYWMTI 73

  Fly    99 MTNTSVDS----------------LVLERQYPVAGEA------------HLWHYCSTCQKLVPPR 135
            .|:.:..|                ...|||..:...|            ....||..||.:.|.|
Human    74 FTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDR 138

  Fly   136 SWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAF----LFHLSFGSGQALVYNGILNWTNKAF 196
            :.|||.|:.||||.||||.:..:|:|..|.::||.|    |.:..|.:...|.| .|..|||:. 
Human   139 AHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEY-FIKFWTNEL- 201

  Fly   197 LVVDPLLLMFQDTTQDADFKWKYTIANLFKLNLFLFGVPLFMFVFQMIMVYRNST---------- 251
                            .|.:.|:.:..||.::...|...|.:|.:...:|.:|.|          
Human   202 ----------------TDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTF 250

  Fly   252 CYKMLDRSYDVGWRRNFDMVLG-KRRFWIFFSPTISS 287
            .|......:.:|..:|:..|.| ::::|:.  |..||
Human   251 SYGPDGNGFSLGCSKNWRQVFGDEKKYWLL--PIFSS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 41/131 (31%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 66/293 (23%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.