DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_659136.1 Gene:Zdhhc5 / 228136 MGIID:1923573 Length:715 Species:Mus musculus


Alignment Length:294 Identity:69/294 - (23%)
Similarity:109/294 - (37%) Gaps:84/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLE 110
            ||||:....|.|.:         |.| |:...:...:.||..|     .:|..:.|.|:.:.:..
Mouse    21 AIFLVGATTLFFAF---------TCP-GLSLNVSPAVPIYNAI-----MFLFVLANFSMATFMDP 70

  Fly   111 RQYPVAGE---------AHLW------------HYCSTCQKLVPPRSWHCSLCNICILKRDHHCT 154
            ..:|.|.|         |.|:            .:|:||:...|||..|||:|:.|:.:.||||.
Mouse    71 GIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCP 135

  Fly   155 FFASCIGHKNQRYFLAFLFHLS------FGSGQALVYNGILNWTNKAFLVVDPLLLMFQDTTQDA 213
            :..:|||.:|.|||..||..|:      ||.|                     ||.:.....:.:
Mouse   136 WVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFG---------------------LLYVLYHIEELS 179

  Fly   214 DFKWKYTIANLFKLNLFLFGVPLF-MFVFQMIMVYRNSTCYKMLD-------RSYDVGWRRNFDM 270
            ..:...|:|.:....||.  :|:. :..|.:::|.|..|..:.:.       ..:..|...|...
Mouse   180 GVRTAVTMAVMCVAGLFF--IPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSR 242

  Fly   271 VL-----------GKRRFWIFFSPTISSPLPTDG 293
            ||           .|:...|...|....|..:||
Mouse   243 VLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 38/134 (28%)
Zdhhc5NP_659136.1 zf-DHHC 99..224 CDD:279823 39/147 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.