DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_666185.3 Gene:Zdhhc14 / 224454 MGIID:2653229 Length:489 Species:Mus musculus


Alignment Length:271 Identity:65/271 - (23%)
Similarity:100/271 - (36%) Gaps:101/271 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FC----------AIFLLCLI------GLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILG 92
            ||          .:|.|.||      ||.|.::..|:..:||.            .|..|..||.
Mouse    50 FCNGRIMMARQTGVFYLTLILILVTSGLFFAFDCRYLAEKITP------------AIPVVGGILF 102

  Fly    93 NWWLGCMTNTSV------------DSLVLERQYPVA--------------------GEAHLWHYC 125
            .:.:|.:..||.            ::..||||..:|                    |:.....||
Mouse   103 FFVMGTLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVVINGQTVKLKYC 167

  Fly   126 STCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSG--QALVYNGI 188
            .||:...|||:.|||||:.|:.:.||||.:..:|:|.:|.|:|..|:..|||.:.  .|.|...:
Mouse   168 FTCKIFRPPRASHCSLCDNCVEQFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFIFAFVITHV 232

  Fly   189 LNWT-NKAFL---------VVDPLLLMF-------------------QDTTQDADFKWK------ 218
            ::.: .|.||         |::.::..|                   |.|.:|....|.      
Mouse   233 IHRSQQKGFLDALKDSPASVLEAVICFFSVWSIIGLSGFHTYLISSNQTTNEDIKGSWSNKRGKE 297

  Fly   219 ----YTIANLF 225
                |:..|:|
Mouse   298 NYNPYSYGNIF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 40/144 (28%)
Zdhhc14NP_666185.3 zf-DHHC 164..289 CDD:307600 36/124 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.