Sequence 1: | NP_651428.2 | Gene: | CG4956 / 43114 | FlyBaseID: | FBgn0039370 | Length: | 302 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_666185.3 | Gene: | Zdhhc14 / 224454 | MGIID: | 2653229 | Length: | 489 | Species: | Mus musculus |
Alignment Length: | 271 | Identity: | 65/271 - (23%) |
---|---|---|---|
Similarity: | 100/271 - (36%) | Gaps: | 101/271 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 FC----------AIFLLCLI------GLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILG 92
Fly 93 NWWLGCMTNTSV------------DSLVLERQYPVA--------------------GEAHLWHYC 125
Fly 126 STCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSG--QALVYNGI 188
Fly 189 LNWT-NKAFL---------VVDPLLLMF-------------------QDTTQDADFKWK------ 218
Fly 219 ----YTIANLF 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4956 | NP_651428.2 | zf-DHHC | 123..251 | CDD:279823 | 40/144 (28%) |
Zdhhc14 | NP_666185.3 | zf-DHHC | 164..289 | CDD:307600 | 36/124 (29%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 434..454 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |