Sequence 1: | NP_651428.2 | Gene: | CG4956 / 43114 | FlyBaseID: | FBgn0039370 | Length: | 302 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766053.1 | Gene: | Zdhhc9 / 208884 | MGIID: | 2444393 | Length: | 364 | Species: | Mus musculus |
Alignment Length: | 288 | Identity: | 59/288 - (20%) |
---|---|---|---|
Similarity: | 101/288 - (35%) | Gaps: | 96/288 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 RSTCGWSRRMCFRAEEGFHRHFQLHRIKVMGLLHPFCAIFLLCLIGLLFVYELCYVLPQITDPHG 73
Fly 74 IWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLERQYP------------------------ 114
Fly 115 -------VAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFL 172
Fly 173 FHLSFGSGQALVYNGI---LNWTNKAFL---------VVDPLLLMF------------------- 206
Fly 207 QDTTQDADFKW--------KYTIANLFK 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4956 | NP_651428.2 | zf-DHHC | 123..251 | CDD:279823 | 39/143 (27%) |
Zdhhc9 | NP_766053.1 | DHHC | 138..261 | CDD:396215 | 35/122 (29%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 303..364 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |