DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and dhhc-5

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_498488.2 Gene:dhhc-5 / 187870 WormBaseID:WBGene00020066 Length:244 Species:Caenorhabditis elegans


Alignment Length:183 Identity:52/183 - (28%)
Similarity:73/183 - (39%) Gaps:49/183 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGIL 189
            |..|....|||..||..||:|:.:.||||.....||...|.:|||.||.                
 Worm    84 CQLCNYRKPPRWHHCRRCNLCVHRMDHHCPILQLCIHSGNHKYFLLFLV---------------- 132

  Fly   190 NWTNKAFLVVDPL-LLMFQDTTQDADFKWKYTIANLFKL---------------NLFLFGV-PLF 237
             |         || |.:|.......|| || ||.:::..               |..:.|: .|:
 Worm   133 -W---------PLQLAIFTIWHGYYDF-WK-TIRSVYTAEILSTSEQLKGTGVSNALMVGIAALY 185

  Fly   238 MFVFQMIMVYRNSTCYK--MLDRSYDVG-WRRNFDMVLGKRRF-WIFFSPTIS 286
            :...|:..:.||.|..:  ..:.||::| |:.|...|:|.... |:.||.|.|
 Worm   186 LLKNQLPNLMRNQTLIEESRENTSYNLGSWQENVKSVMGAWTIAWLPFSVTKS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 39/142 (27%)
dhhc-5NP_498488.2 zf-DHHC 77..202 CDD:279823 40/145 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.