DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and dhhc-13

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_500889.2 Gene:dhhc-13 / 186797 WormBaseID:WBGene00019257 Length:593 Species:Caenorhabditis elegans


Alignment Length:208 Identity:48/208 - (23%)
Similarity:76/208 - (36%) Gaps:54/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FCAIFLLCLIGLLFVYELCYVLPQ--------------------------ITDPHGI--WHKLCW 80
            |...|.:.|.||.....|.::|.|                          |.:.:|:  |..|.:
 Worm   298 FLTNFWVVLGGLALTALLLFILVQRRQMDQFGCLPVTYIFWMGIAEFALLIFNSNGLVHWSVLIF 362

  Fly    81 FMGIYTVINILGNWWLGCMTN--------TSVDSLVLERQYPVAGEAHLWHYCSTCQKLVPPRSW 137
            ...|:.:  ....:|:..:||        |.....:.:.:     |..:..||.||.......|.
 Worm   363 VCSIWVI--SASFYWILILTNPGVLPRSTTPFKDFIKDLE-----EKQIDRYCFTCWIPKTSSSH 420

  Fly   138 HCSLCNICILKRDHHCTFFASCIGHKNQRYFL-----AFLFH------LSFGSGQALVYNGILNW 191
            |||.|:.|:...||||.:...|:..||.|.|:     .|:||      |.:..|.::..:|....
 Worm   421 HCSQCDKCVDGFDHHCPWIHKCVYRKNLRAFVFFCLTIFMFHVFYVLLLLYMIGASMNASGFEQT 485

  Fly   192 TNKAFLVVDPLLL 204
            .|...|:|..|:|
 Worm   486 LNDHGLMVISLIL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 30/93 (32%)
dhhc-13NP_500889.2 ANK 42..155 CDD:238125
Ank_2 42..132 CDD:289560
ANK repeat 67..98 CDD:293786
ANK repeat 101..132 CDD:293786
Ank_5 121..176 CDD:290568
ANK 130..>240 CDD:238125
Ank_5 198..243 CDD:290568
ANK repeat 206..234 CDD:293786
zf-DHHC 405..530 CDD:279823 30/94 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.