DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and zdhhc13

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_002942880.3 Gene:zdhhc13 / 100493145 XenbaseID:XB-GENE-997024 Length:612 Species:Xenopus tropicalis


Alignment Length:271 Identity:59/271 - (21%)
Similarity:102/271 - (37%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLE 110
            ||...|.|..:|:....|.||.:.   .:..:|.:.:.:..:.......|  |.....:.|...|
 Frog   339 AIIFSCCIFWMFLTWFIYFLPGLA---RVAFQLPFIISMLLLFYFFYKTW--CTDPGYIKSSEEE 398

  Fly   111 RQYPV-----AG--EAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYF 168
            .:..:     ||  :|.|  :|::|....|.||.||..||.|:.:.|.||.:...|||..||.:|
 Frog   399 SRQTIITLAEAGCLDARL--FCTSCLVKKPLRSMHCHACNSCVARFDQHCVWTGQCIGAGNQHFF 461

  Fly   169 LAFLFHLSFGSGQALVYNGILNWTN--------------------------------KAFLVVDP 201
            :.||..|:. .|..::|...:.|::                                .||.|...
 Frog   462 VLFLASLAV-VGNWMIYATSVYWSDHCGMGSRKDGIWATLSQIVNCSPWVLYIFCLVSAFTVWAT 525

  Fly   202 LLLMFQ--------DTTQDADFKWKYTIANL-FKLNLFLFGVPLFMFVFQMIMVYRNSTCYKMLD 257
            |:|:.|        .|||:   :....:.|. .|..:.|...|......|.:..:.:..|:.:: 
 Frog   526 LMLLVQLFQISFLGLTTQE---RISLQVQNRHLKHQVSLRRTPFNRGCLQNLADFFHCQCFGLI- 586

  Fly   258 RSYDVGWRRNF 268
            :|..:.|.:.:
 Frog   587 KSQPIDWTKQY 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 39/168 (23%)
zdhhc13XP_002942880.3 Ank_2 46..136 CDD:372319
ANK repeat 71..102 CDD:293786
PHA03095 82..>246 CDD:222980
ANK repeat 104..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK repeat 171..237 CDD:293786
DHHC 327..>549 CDD:388695 51/220 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.