Sequence 1: | NP_651428.2 | Gene: | CG4956 / 43114 | FlyBaseID: | FBgn0039370 | Length: | 302 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002942880.3 | Gene: | zdhhc13 / 100493145 | XenbaseID: | XB-GENE-997024 | Length: | 612 | Species: | Xenopus tropicalis |
Alignment Length: | 271 | Identity: | 59/271 - (21%) |
---|---|---|---|
Similarity: | 102/271 - (37%) | Gaps: | 60/271 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 AIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLE 110
Fly 111 RQYPV-----AG--EAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYF 168
Fly 169 LAFLFHLSFGSGQALVYNGILNWTN--------------------------------KAFLVVDP 201
Fly 202 LLLMFQ--------DTTQDADFKWKYTIANL-FKLNLFLFGVPLFMFVFQMIMVYRNSTCYKMLD 257
Fly 258 RSYDVGWRRNF 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4956 | NP_651428.2 | zf-DHHC | 123..251 | CDD:279823 | 39/168 (23%) |
zdhhc13 | XP_002942880.3 | Ank_2 | 46..136 | CDD:372319 | |
ANK repeat | 71..102 | CDD:293786 | |||
PHA03095 | 82..>246 | CDD:222980 | |||
ANK repeat | 104..136 | CDD:293786 | |||
ANK repeat | 138..169 | CDD:293786 | |||
ANK repeat | 171..237 | CDD:293786 | |||
DHHC | 327..>549 | CDD:388695 | 51/220 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |